PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_21804_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 320aa    MW: 35928.1 Da    PI: 4.545
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_21804_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.7e-1985139357
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     k++++t++q++ Le+ Fe ++++  e++ +LAk+lgL+ rqV +WFqNrRa+ k+
  Neem_21804_f_1  85 KKRRLTATQVQFLEKNFEVENKLEPERKVQLAKELGLQPRQVAIWFQNRRARSKN 139
                     56689***********************************************995 PP

2HD-ZIP_I/II121.93.2e-3985174291
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     kkrrl++ qv++LE++Fe e+kLeperKv+la+eLglqprqva+WFqnrRAR k+++lEkdy++Lk+ayd+lk++ ++L ke+e L++e+
  Neem_21804_f_1  85 KKRRLTATQVQFLEKNFEVENKLEPERKVQLAKELGLQPRQVAIWFQNRRARSKNQRLEKDYDSLKAAYDKLKTDYDNLLKEKEVLHDEV 174
                     9*************************************************************************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.98E-1977141IPR009057Homeodomain-like
PROSITE profilePS5007117.18480140IPR001356Homeobox domain
SMARTSM003895.7E-1882144IPR001356Homeobox domain
CDDcd000861.96E-1783141No hitNo description
PfamPF000462.7E-1685138IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-1987148IPR009057Homeodomain-like
PRINTSPR000314.9E-6111120IPR000047Helix-turn-helix motif
PROSITE patternPS000270115138IPR017970Homeobox, conserved site
PRINTSPR000314.9E-6120136IPR000047Helix-turn-helix motif
PfamPF021833.2E-12141181IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MAGGNICGSP NVAALLRNEK LPCSSNVLES FWMPKSSPTI QAPKPVVNFA NVGGGDTTST  60
QLFESLDKQQ NGFEDFEGCF NPPGKKRRLT ATQVQFLEKN FEVENKLEPE RKVQLAKELG  120
LQPRQVAIWF QNRRARSKNQ RLEKDYDSLK AAYDKLKTDY DNLLKEKEVL HDEVLVLQDK  180
LLIKEKGKEK SETPDAVNSL EAEPQKPITD TDTKLVSNVP VFACKQEDAN SVKSDVLDSS  240
GSPHSTDGNH SSLIDPADSS QAFEPEQSDF SQDEEDNLGK GLLPPPYFLK LEDCCYDDPR  300
TNSCNLGFSI EDQPFWFWPY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007044376.11e-143Homeobox-leucine zipper protein HAT5, putative isoform 1
TrEMBLA0A061E6H91e-143A0A061E6H9_THECC; Homeobox-leucine zipper protein HAT5, putative isoform 1
STRINGVIT_01s0026g01550.t011e-126(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54528143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.15e-38homeobox 1